Copy Number

 

The putative cancer-associated GESPs driven by SCNAs in each cancer type were identified by four criteria: 1) located in a peak region of a significantly recurrent focal SNCA locus estimated by the genomic identification of significant targets in cancer (GISTIC2) algorithm, (q≤0.25); 2) altered with high frequency and large amplitude (G-score ≥0.1); 3) mRNA reliably detected in at least 10% of tumor specimens in the given cancer type (90th percentile of FPKM value ≥1); and 4) mRNA significantly and positively correlated with copy numbers (Pearson P-value less than 0.001).

 

List of the putative cancer-causing GESPs driven by SCNAs in each cancer type


 Show   entries each page
 Jump to page  

 
 Showing page 43  first page | previous page | next page | last page 
 
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM
 HGNC Name  Ensembl Gene ID  HGNC Symbol  Genomic Location  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del 
kirre like nephrin family adhesion molecule 3ENSG00000149571KIRREL3chr11:126423359-127003460:-                                                                                                                                                              1                                                                                                          
leukocyte immunoglobulin like receptor B1ENSG00000104972LILRB1chr19:54617158-54700954:+                                                                                                                      1                                                                                                                                                  
leukocyte immunoglobulin like receptor A1ENSG00000104974LILRA1chr19:54573879-54602090:+                                                                                                                      1                                                                                                                                                  
osteoclast associated Ig-like receptorENSG00000170909OSCARchr19:54094668-54102692:-                                                                                                                      1                                                                                                                                                  
leukocyte immunoglobulin like receptor B3ENSG00000204577LILRB3chr19:54216278-54223506:-                                                                                                                      1                                                                                                                                                  
leukocyte immunoglobulin like receptor B2ENSG00000131042LILRB2chr19:54238904-54281184:-                                                                                                                      1                                                                                                                                                  
leukocyte immunoglobulin like receptor A2ENSG00000239998LILRA2chr19:54572920-54590287:+                                                                                                                      1                                                                                                                                                  
leukocyte immunoglobulin like receptor B4ENSG00000186818LILRB4chr19:54643889-54670359:+                                                                                                                      1                                                                                                                                                  
sodium voltage-gated channel beta subunit 3ENSG00000166257SCN3Bchr11:123629187-123655244:-                                                                                                                                                              1                                                                                                          
calcium voltage-gated channel auxiliary subunit gamma 7ENSG00000105605CACNG7chr19:53909335-53943941:+                                                                                                                      1                                                                                                                                                  
V-set and immunoglobulin domain containing 2ENSG00000019102VSIG2chr11:124747472-124752238:-                                                                                                                                                              1                                                                                                          
myeloid associated differentiation markerENSG00000179820MYADMchr19:53866223-53876437:+                                                                                                                      1                                                                                                                                                  
RAB35, member RAS oncogene familyENSG00000111737RAB35chr12:120095095-120117502:-                                      1                                                                                                                                                                                                                                  
activin A receptor type 2AENSG00000121989ACVR2Achr2:147844517-147930826:+                                                                                                                                                                                      1                                                                                  
calcium voltage-gated channel auxiliary subunit alpha2delta 2ENSG00000007402CACNA2D2chr3:50362799-50504244:-                      1                                                                                                                                                                                                                                                  
LDL receptor related protein 6ENSG00000070018LRP6chr12:12116025-12267012:-                                                                                                                                                                                                      1                                                                  
potassium voltage-gated channel subfamily Q member 1ENSG00000053918KCNQ1chr11:2444684-2849109:+                                                                                                                                              1                                                                                                                          
LMBR1 domain containing 1ENSG00000168216LMBRD1chr6:69675802-69797111:-                                                                                                                                                                                                      1                                                                  
myosin VIENSG00000196586MYO6chr6:75749192-75919537:+                                                      1                                                                                                                                                                                                                  
ATPase phospholipid transporting 8B3ENSG00000130270ATP8B3chr19:1782075-1812276:-                                                              1                                                                                                                                                                                                          

 Showing page 43 
first page | previous page | next page | last page 








Contact us | | Terms & Conditions.
Copyright © 2020 University of Pennsylvania. All Rights Reserved.