Copy Number

 

The putative cancer-associated GESPs driven by SCNAs in each cancer type were identified by four criteria: 1) located in a peak region of a significantly recurrent focal SNCA locus estimated by the genomic identification of significant targets in cancer (GISTIC2) algorithm, (q≤0.25); 2) altered with high frequency and large amplitude (G-score ≥0.1); 3) mRNA reliably detected in at least 10% of tumor specimens in the given cancer type (90th percentile of FPKM value ≥1); and 4) mRNA significantly and positively correlated with copy numbers (Pearson P-value less than 0.001).

 

Summary of the G-score of the putative cancer-causing GESPs driven by SCNAs in each cancer type


 Show   entries each page
 Jump to page  

 
 Showing page 39  first page | previous page | next page | last page 
 
ACCBLCABRCACESCCHOLCOADDLBCESCAGBMHNSCKICHKIRCKIRPLAMLLGGLIHCLUADLUSCMESOOVPAADPCPGPRADREADSARCSKCMSTADTGCTTHCATHYMUCECUCSUVM
 HGNC Name  Ensembl Gene ID  HGNC Symbol  Genomic Location  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del  Amp  Del 
discoidin, CUB and LCCL domain containing 1ENSG00000164465DCBLD1chr6:117453817-117569858:+              0.11                                                                                                                                                                                                0.13                                                          
netrin G2ENSG00000196358NTNG2chr9:132161676-132244534:+                                                                                                                                                              0.24                                                                                                          
synaptotagmin like 1ENSG00000142765SYTL1chr1:27342020-27353937:+                                                                                                                                                                                              0.24                                                                          
transmembrane protein 30BENSG00000182107TMEM30Bchr14:61277370-61281840:-                                                                                                                                                              0.24                                                                                                          
interleukin 6 signal transducerENSG00000134352IL6STchr5:55935095-55994993:-                                                                                                                                                                                      0.24                                                                                  
potassium sodium-activated channel subfamily T member 1ENSG00000107147KCNT1chr9:135702185-135795508:+                                                                                                                                                              0.24                                                                                                          
chromosome 1 open reading frame 162ENSG00000143110C1orf162chr1:111473792-111478512:+                      0.1                                                                                                                0.14                                                                                                                                  
contactin associated protein family member 3ENSG00000106714CNTNAP3chr9:39072767-39288315:-                                                                              0.11                                                                0.13                                                                                                                          
neural cell adhesion molecule 1ENSG00000149294NCAM1chr11:112961247-113278436:+                      0.24                                                                                                                                                                                                                                                  
solute carrier family 38 member 6ENSG00000139974SLC38A6chr14:60981114-61083733:+                                                                                                                                                              0.24                                                                                                          
peptidylglycine alpha-amidating monooxygenaseENSG00000145730PAMchr5:102753981-103031105:+                                                              0.1                                                                                                                                                        0.13                                                  
CD53 moleculeENSG00000143119CD53chr1:110873154-110899928:+                      0.1                                                                                                                0.13                                                                                                                                  
potassium voltage-gated channel subfamily C member 4ENSG00000116396KCNC4chr1:110211343-110283100:+                      0.1                                                                                                                0.13                                                                                                                                  
neuronal calcium sensor 1ENSG00000107130NCS1chr9:130172578-130237304:+                                                                                                                                                              0.23                                                                                                          
family with sequence similarity 174 member AENSG00000174132FAM174Achr5:100535305-100586741:+                                                              0.1                                                                                                                                                        0.13                                                  
G protein-coupled receptor 135ENSG00000181619GPR135chr14:59429022-59465342:-                                                                                                                                                              0.23                                                                                                          
pecanex 4ENSG00000126773PCNXL4chr14:60091911-60169133:+                                                                                                                                                              0.23                                                                                                          
interleukin 10 receptor subunit alphaENSG00000110324IL10RAchr11:117986348-118001483:+                      0.23                                                                                                                                                                                                                                                  
junction adhesion molecule likeENSG00000160593AMICA1chr11:118193740-118225094:-                      0.23                                                                                                                                                                                                                                                  
transforming growth factor beta receptor 3ENSG00000069702TGFBR3chr1:91680343-91906335:-                      0.1                                                                                                                                                                                        0.12                                                          

 Showing page 39 
first page | previous page | next page | last page 








Contact us | | Terms & Conditions.
Copyright © 2020 University of Pennsylvania. All Rights Reserved.